CJC-1295 DAC 5mg

49 customer reviews

$72.00

CJC-1295 DAC 5mg

Availability: Expedited shipping if ordered and paid by 12 PM MT

Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.

Description

CJC-1295: A Comprehensive Overview

CJC-1295 is a synthetic peptide that acts as a growth hormone-releasing hormone (GHRH) analog, enhancing the release of growth hormone (GH) and insulin-like growth factor 1 (IGF-1) in the body. It’s particularly noted for its potential applications in growth hormone deficiency, sleep quality improvement, body composition, and anti-aging​​.

CJC-1295 Chemical Composition

  • Chemical Structure: CJC-1295 is a tetrasubstituted peptide of 30 amino acids. It is a modified version of the first 29 amino acids of GHRH, with a substitution of four amino acids to enhance its stability and half-life.
  • CAS No: 863288-34-0
  • Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
  • Molecular Formula: The molecular formula for CJC-1295 without DAC (Drug Affinity Complex) is C152H252N44O42. For CJC-1295 with DAC, which further increases its half-life, the formula includes additional components due to the DAC technology.
  • Stability: CJC-1295 is stable at room temperature for a period but should be stored in a freezer (-18°C) in a lyophilized form for long-term storage. Once reconstituted with bacteriostatic water, it should be kept refrigerated and used within a few weeks.
  • Solubility: It is soluble in water and bacteriostatic water, making it suitable for subcutaneous or intramuscular injection.
  • Mechanism of Action: CJC-1295 acts by binding to the GHRH receptor on the pituitary gland, mimicking the effects of endogenous GHRH. It significantly increases plasma levels of growth hormone and IGF-1 (Insulin-like Growth Factor 1) without increasing prolactin levels, leading to growth hormone’s various physiological effects.
  • Therapeutic Use: While not approved for any specific medical treatments by major regulatory agencies like the FDA, CJC-1295 is researched for its potential to enhance GH levels, which could be beneficial for growth hormone deficiency, muscle wasting, obesity, and anti-aging purposes.
  • Efficacy: Studies and anecdotal evidence suggest that CJC-1295 can increase GH levels, improve muscle mass, reduce body fat, and enhance recovery and sleep quality. However, rigorous clinical data in humans are limited.
  • Side Effects: Potential side effects include injection site reactions, headache, flushing, hyperglycemia, and decreased insulin sensitivity. As with any compound that increases GH levels, there is a concern about the potential long-term impacts on glucose metabolism and the risk of acromegaly with excessive use.
  • Safety Profile: The long-term safety profile of CJC-1295 in humans is not fully established, with most available data coming from animal studies or short-term human use.
  • Legal Status and Availability: CJC-1295 is available as a research chemical but is not approved for medical use. It is often used in the bodybuilding community and by those seeking anti-aging therapies.
  • Shelf Life: 36 months
  • Appearance: White lipolyzed powder puck

CJC 1295Benefits and Applications

CJC-1295 has been linked to several beneficial effects, including improved sleep cycles, increased lean muscle mass, deeper sleep, faster injury and wound healing, and overall body composition improvements. These effects contribute significantly to its popularity among athletes and bodybuilders looking to enhance muscle growth and recovery​​​​.

Dosage and Administration

The recommended dosage for CJC-1295 varies, with suggestions of 30 to 60 mcg per kg of body weight, administered once a week due to its long half-life. Cycling the peptide for twelve weeks with a month-long break afterwards is commonly recommended for optimal results​​.

Side Effects

While CJC-1295 is generally well-tolerated, potential side effects include vertigo and increased body temperature, especially for new users or those taking higher doses. Starting with lower doses and gradually increasing as needed can help minimize these risks​​.

Legal and Safety Considerations

CJC-1295 is not yet approved by the FDA for human consumption but can be purchased online for research purposes. Its legal status varies by country​​. Moreover, CJC-1295 is on the list of substances prohibited by regulatory bodies due to its performance-enhancing potential, although it may still be useful for non-competing individuals to build muscle and increase lean body mass​​.

Comparisons with Other Peptides

CJC-1295 often gets compared with Sermorelin, another synthetic peptide that stimulates the body’s natural production of HGH. Sermorelin is recognized for its anti-aging benefits, enhancing muscle growth, reducing fat accumulation, and improving overall vitality. It’s regulated and FDA-approved, making it a safer and more accessible option for addressing age-related concerns​​.

Conclusion

CJC-1295 presents a promising option for those interested in the potential benefits of increased growth hormone levels, such as enhanced muscle growth, improved sleep quality, and better overall body composition. However, it’s important to approach its use with caution, considering the lack of FDA approval and potential side effects. Always consult with a healthcare professional before beginning any new supplement regimen.

Referenced Citations

  1. Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295, a long-acting analog of GH-releasing hormone, in healthy adults
    (https://pubmed.ncbi.nlm.nih.gov/16352683/)
  2. Once-daily administration of CJC-1295, a long-acting growth hormone-releasing hormone (GHRH) analog, normalizes growth in the GHRH knockout mouse (https://pubmed.ncbi.nlm.nih.gov/16822960/)
  3. Activation of the GH/IGF-1 axis by CJC-1295, a long-acting GHRH analog, in healthy young adult men (https://pubmed.ncbi.nlm.nih.gov/17229738/)
  4. Netnography of Female Use of the Synthetic Growth Hormone CJC-1295: Insights from an Online Forum (https://pubmed.ncbi.nlm.nih.gov/29565638/)
  5. Qualitative identification of growth hormone-releasing hormones in doping control analysis using mass spectrometry (https://pubmed.ncbi.nlm.nih.gov/23595672/)
  6. Identification of CJC-1295, a growth-hormone-releasing peptide, in an unknown pharmaceutical product (https://pubmed.ncbi.nlm.nih.gov/22024083/)
  7. Advances in the detection of growth hormone releasing hormone analogs in anti-doping analysis (https://pubmed.ncbi.nlm.nih.gov/21696301/)
  8. Pulsatile secretion of growth hormone (GH) persists during continuous stimulation by CJC-1295, a long-acting GHRH analog (https://pubmed.ncbi.nlm.nih.gov/15817669/)
  9. Human growth hormone-releasing factor (hGRF)1-29-albumin bioconjugates activate the GRF receptor on the anterior pituitary in rats: identification of CJC-1295 as a long-lasting GRF analog (https://pubmed.ncbi.nlm.nih.gov/15817669/)
  10. An Immuno Polymerase Chain Reaction Screen for the Detection of CJC-1295 and Other GH Secretagogues in Sports Doping (https://pubmed.ncbi.nlm.nih.gov/22147493/)
Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.

Recently Viewed Products

You haven't viewed at any of the products yet.

You’re reviewing:  

Be the first to know

Receive all the latest information on events, sales, & offers.